Shewanella pealeana: Spea_3888 Help Entry Spea_3888         CDS       T00606                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism spl  Shewanella pealeana Pathway spl01100   Metabolic pathways spl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Spea_3888    00074 Mycolic acid biosynthesis     Spea_3888   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Spea_3888 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABV89198 UniProt:  A8H9G1 LinkDB All DBs Position 4735646..4735900 Genome browser AA seq 84 aa AA seqDB search MSLDNEIKQLIIDCLDLEDVSIDDIDSEAALFGEGLGLDSIDALELGLAIKKQFDVKIEA NSDATKQHFYSVASLVSFIESQRA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagcttagataacgaaattaaacaactgatcatcgactgtctggatttagaagacgtc agtattgatgatatcgactcagaagcggcactattcggtgagggcctaggcctagactca attgatgcgttggaacttggcttagcgattaaaaagcaatttgatgtgaagattgaagcg aattctgacgcaacaaaacagcacttctatagcgttgctagcttggtcagttttattgag tcacaacgagcctag

DBGET integrated database retrieval system