Shewanella pealeana: Spea_3889 Help Entry Spea_3889         CDS       T00606                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism spl  Shewanella pealeana Pathway spl01100   Metabolic pathways spl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Spea_3889    00074 Mycolic acid biosynthesis     Spea_3889   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Spea_3889 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding WGG Motif Other DBs NCBI-ProteinID:  ABV89199 UniProt:  A8H9G2 LinkDB All DBs Position 4735909..4736157 Genome browser AA seq 82 aa AA seqDB search MQSREQILEMLTQILVDEFEVDAEDITLEASLYEELDLDSIDAVDLVIKLQQMTGKKIKP EEFKAVRTVDDVVSAIEGLVKE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaagtcgtgaacagatccttgagatgctgactcaaatcttagtcgacgagttcgag gtggatgccgaagatatcaccctagaagcttctttatatgaagagctcgatttagacagc atcgacgccgttgacttagtgatcaagttacagcagatgacaggtaagaaaattaagcct gaagagtttaaagccgttagaaccgtagatgatgtggtatcagctatcgaaggcttagtt aaagagtaa

DBGET integrated database retrieval system