KEGG   Streptomyces platensis: CP981_34450
Entry
CP981_34450       CDS       T07341                                 
Name
(GenBank) PPOX class F420-dependent oxidoreductase
  KO
K21301  5a,11a-dehydrotetracycline reductase [EC:1.3.98.4]
Organism
spla  Streptomyces platensis
Pathway
spla00253  Tetracycline biosynthesis
spla01057  Biosynthesis of type II polyketide products
spla01100  Metabolic pathways
spla01110  Biosynthesis of secondary metabolites
Module
spla_M00780  Tetracycline/oxytetracycline biosynthesis, pretetramide => tetracycline/oxytetracycline
Brite
KEGG Orthology (KO) [BR:spla00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    CP981_34450
   00253 Tetracycline biosynthesis
    CP981_34450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:spla01008]
    CP981_34450
Enzymes [BR:spla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.4  5a,11a-dehydrotetracycline reductase
     CP981_34450
Polyketide biosynthesis proteins [BR:spla01008]
 Polyketide tailoring proteins
  Others
   CP981_34450
SSDB
Motif
Pfam: Putative_PNPOx Pyridox_ox_2
Other DBs
NCBI-ProteinID: QEV56029
LinkDB
Position
7807384..7807848
AA seq 154 aa
MPFTPKEISYMRSQGYGRLATVGPNGEPHNVPVSFQFDDGNGVIEITGRNMGRSQKYRNV
LANDRVAFVVDDIPCRDPEVVRAVVVHGRARALTAGGKARRPHCDEEMIAIRPLRIISWG
IEGDLSTGAHSRRIASEETVKAEKTEKAEEGARR
NT seq 465 nt   +upstreamnt  +downstreamnt
atgccgttcaccccgaaagaaatcagctatatgcggtcccaaggttacggccggctggcc
acggttggcccgaacggagaaccgcacaatgtccccgtctcgttccagttcgacgacggt
aacggcgttatcgagatcaccgggaggaatatgggacgtagtcagaagtaccgcaatgtg
ctggcgaacgacagggttgccttcgtcgtcgatgacattccctgtcgtgatccggaagtg
gtacgggccgtggtcgtccacgggcgggcaagggcgctgaccgccggcggaaaagcccgc
cgcccgcactgcgatgaggagatgatcgcgattcgcccgctgcggatcatcagctggggc
atcgaaggcgacctgtccaccggtgcccactcccgccggatcgcgagcgaggagaccgtg
aaggcggaaaagaccgaaaaggcggaggagggggcgcggcgatga

DBGET integrated database retrieval system