Streptomyces platensis: CP981_34520 Help Entry CP981_34520       CDS       T07341                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism spla  Streptomyces platensis Pathway spla00253   Tetracycline biosynthesis spla01056   Biosynthesis of type II polyketide backbone spla01100   Metabolic pathways spla01110   Biosynthesis of secondary metabolites Module spla_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:spla00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     CP981_34520    00253 Tetracycline biosynthesis     CP981_34520  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:spla01004]     CP981_34520    01008 Polyketide biosynthesis proteins [BR:spla01008]     CP981_34520 Lipid biosynthesis proteins [BR:spla01004]  Polyketide synthase   Component type    CP981_34520 Polyketide biosynthesis proteins [BR:spla01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      CP981_34520     Nonaketide PKS      CP981_34520     Decaketide PKS      CP981_34520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEV56042 UniProt:  A0AAE6TQH3 LinkDB All DBs Position complement(7822698..7822985) Genome browser AA seq 95 aa AA seqDB search MTSLTLDDLLTLLRECAGEDESVDLDGDVLDLPFDNLGYDSLALLNTVGRIERDYGVRLG DDALESAGTPRELIEMTNAALAGSRRPAPGAAREK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgacctccctgactctcgacgacctgctgaccctgctgcgcgagtgcgcgggcgaggac gagtccgtcgacctggacggcgatgtcctcgacctccccttcgacaacctcggctatgac tcactggcccttctcaacaccgtcggccgcatcgagcgcgactacggcgtccgcctgggc gacgacgcgctggaaagcgcaggtacaccgcgcgagctgatcgagatgaccaacgcggcg ctcgccggctcccggcggcccgcgcccggcgccgcgcgggagaagtga

DBGET integrated database retrieval system