Streptomyces platensis: CP981_37130 Help Entry CP981_37130       CDS       T07341                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spla  Streptomyces platensis Pathway spla00998   Biosynthesis of various antibiotics spla01100   Metabolic pathways spla01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spla00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CP981_37130   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CP981_37130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEV56468 LinkDB All DBs Position complement(8411197..8411442) Genome browser AA seq 81 aa AA seqDB search MSTVREMLVELTGTREFADVLGEDTDLSASGIDSGDLVRLVLLIEQHTGVEVTGKDMEGL TTLGDYERFVAERGGTSPGGS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagtaccgtacgggagatgctggtcgagctgaccggcactcgggagttcgccgacgtc ctcggtgaagacaccgacctcagtgccagcggcatcgactcgggagacctggtgcgcctg gttctgctcatcgagcagcacaccggggtggaggtcaccggcaaggatatggaggggctg accaccctcggcgactacgagcgcttcgtcgccgagcgcggcggcacctcccccggcggc tcgtga

DBGET integrated database retrieval system