Sulfuriferula plumbiphila: SFPGR_22700 Help Entry SFPGR_22700       CDS       T06621                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism splb  Sulfuriferula plumbiphila Pathway splb01100   Metabolic pathways splb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:splb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SFPGR_22700 (acpP)    00074 Mycolic acid biosynthesis     SFPGR_22700 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SFPGR_22700 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 DUF1493 HLH DUF5783 Motif Other DBs NCBI-ProteinID:  BBP04848 LinkDB All DBs Position complement(2211517..2211756) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVNEADVKTESSFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVKLAIDYINSHLAK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaatatcgaacagcgtgtcaagaaaatcgtcgccgaacaactgggcgtgaacgaa gcggacgttaaaaccgaatcttcctttgtcgatgatttgggtgcggattcgctggatacg gttgaattggtcatggcacttgaagaagagttcgagtgcgaaatccctgacgaagaagcc gaaaaaatcaccaccgtcaaactggccattgattacatcaatagccatctcgccaagtaa

DBGET integrated database retrieval system