Sphingomonas sp. LK11: AV944_12275 Help Entry AV944_12275       CDS       T04954                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism splk  Sphingomonas sp. LK11 Pathway splk01100   Metabolic pathways splk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:splk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AV944_12275    00074 Mycolic acid biosynthesis     AV944_12275   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AV944_12275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  APX66475 LinkDB All DBs Position complement(2670548..2670784) Genome browser AA seq 78 aa AA seqDB search MSETADRVKKIVVEHLGVEADKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVKDAITYIDENKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccgccgaccgcgtgaagaagatcgtcgtcgagcatctcggcgtcgaagcc gacaaggtgaccgaggacgcgagcttcatcgacgacctcggtgccgacagcctcgacatc gtcgagctcgtcatggcgttcgaggaagagttcggtgtcgaaatcccggacgatgccgcc gagaagatcacgaccgtcaaggacgcgatcacctatatcgacgagaacaaggcctaa

DBGET integrated database retrieval system