Sphingomonas sp. LM7: BXU08_03855 Help Entry BXU08_03855       CDS       T04824                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism splm  Sphingomonas sp. LM7 Pathway splm00261   Monobactam biosynthesis splm01100   Metabolic pathways splm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:splm00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BXU08_03855  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:splm01008]     BXU08_03855 Polyketide biosynthesis proteins [BR:splm01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BXU08_03855 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH CO4A-B_CUB_C Glyco_hydro_72 Motif Other DBs NCBI-ProteinID:  AQR72922 LinkDB All DBs Position complement(842339..842578) Genome browser AA seq 79 aa AA seqDB search MSRDEPEDTTIYLAVVNSEEQYSIWPEERELPVGWSAAGKSGSKAEVLAWIQEVWTDMRP LSLRKKMEEAEALRRSQSD NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcccgggacgagccagaggataccaccatctacctcgcggtggtgaactccgaagaa caatattcgatttggcccgaggaacgcgagttgccggtcggctggagcgccgccggcaag tcgggcagcaaggccgaggtgctcgcgtggatccaggaagtatggaccgacatgcggccg ctcagcctgcgcaagaagatggaagaagccgaggcgctgagacgctcccaaagcgactag

DBGET integrated database retrieval system