Sphingomonas sp. LM7: BXU08_17755 Help Entry BXU08_17755       CDS       T04824                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism splm  Sphingomonas sp. LM7 Pathway splm00190   Oxidative phosphorylation splm01100   Metabolic pathways Module splm_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:splm00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BXU08_17755  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:splm00194]     BXU08_17755 Photosynthesis proteins [BR:splm00194]  Photosystem and electron transport system   F-type ATPase [OT]    BXU08_17755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  AQR75264 UniProt:  A0A1S6FNP0 LinkDB All DBs Position complement(3774472..3774723) Genome browser AA seq 83 aa AA seqDB search MLHFELVTPEKLVRSEDVHMVVVPGTEGDFGVLEGHAPLMSTIRDGNLEIYKTGAMAPET IRIEGGFAEVNERGLTVLAEKAE NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgctgcacttcgaactcgtcactcccgaaaagctcgtccgctccgaggacgtgcatatg gtcgtcgtccccggcaccgagggtgatttcggcgtgctcgaaggccatgcgccgctgatg tcgacgatccgcgacggcaatctcgaaatctacaagaccggcgccatggcgcccgagacg atccgcatcgaaggcggtttcgccgaggtcaacgagcgcggcctgaccgtgctcgccgaa aaggccgagtaa

DBGET integrated database retrieval system