Streptomyces pluripotens: LK06_022150 Help Entry LK06_022150       CDS       T04845                                  Name (GenBank) NrdH-redoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism splu  Streptomyces pluripotens Brite KEGG Orthology (KO) [BR:splu00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     LK06_022150 Enzymes [BR:splu01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      LK06_022150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like Thioredoxin_2 GST_N_3 Thioredoxin GST_N_2 Motif Other DBs NCBI-ProteinID:  ARP72206 UniProt:  A0A221P311 LinkDB All DBs Position complement(4924663..4924920) Genome browser AA seq 85 aa AA seqDB search MQGTVTMYSTTWCGYCRRLKSQLDREGIAYTEINIEQDPESAAFVEKANGGNQTVPTVRV LPTSGGDEVVMTNPSLAQVKQALAV NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcagggcactgtgacgatgtacagcacgacgtggtgcggctactgccggcggctgaag agccagctggaccgggaggggatcgcctacaccgagatcaacatcgagcaggacccggag tccgccgctttcgtggagaaggcgaacggcggaaaccagaccgtcccgaccgttcgggta cttcccaccagcggtggcgacgaggtcgtcatgacgaacccgagccttgcccaggtgaag caggctctcgcggtctga

DBGET integrated database retrieval system