Serratia inhibens: Q5A_003985 Help Entry Q5A_003985        CDS       T04576                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism sply  Serratia inhibens Pathway sply00998   Biosynthesis of various antibiotics sply01100   Metabolic pathways sply01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sply00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Q5A_003985 (acpP_2)    00074 Mycolic acid biosynthesis     Q5A_003985 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Q5A_003985 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANS41281 LinkDB All DBs Position 857046..857297 Genome browser AA seq 83 aa AA seqDB search MDKQDIYLQIQALLVKLFELDADDIKPESRLYEELELDSIDAVDLVVHLQKTTGKKIKPE MFKSVRTVQDVVDAIDELLKSDS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggataaacaagatatttacctgcaaattcaggcgctgctggtcaagctgtttgaactg gatgctgatgatatcaaaccggaatcccgcctttacgaagagctggaactggatagcatt gatgcggtagatctggtggtgcatctgcagaaaacgaccggcaagaagattaagccggaa atgttcaagtcggtgcgcaccgtgcaggacgtggttgacgctatcgatgaactgctgaaa tcagacagttaa

DBGET integrated database retrieval system