Serratia inhibens: Q5A_007070
Help
Entry
Q5A_007070 CDS
T04576
Symbol
lgoT_1
Name
(GenBank) putative L-galactonate transporter
KO
K23016
MFS transporter, ACS family, L-galactonate transporter
Organism
sply
Serratia inhibens
Brite
KEGG Orthology (KO) [BR:
sply00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
sply02000
]
Q5A_007070 (lgoT_1)
Transporters [BR:
sply02000
]
Major facilitator superfamily (MFS)
Organic acid transporters
Anion:cation symporter (ACS) family [TC:
2.A.1.14
]
Q5A_007070 (lgoT_1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MFS_1
OATP
3HCDH
Motif
Other DBs
NCBI-ProteinID:
ANS41883
LinkDB
All DBs
Position
complement(1487106..1488464)
Genome browser
AA seq
452 aa
AA seq
DB search
MERTTTVDSGKEQIDPYSDHIIPMPPNGLLVRSARIKKIQTTAMLLLFFAAIINFLDRSS
LSVANSTIREEMGLSGTEIGLLLSAFSLAYGIAQLPCGLLLDRKGPRIMLGVGMFVWSVF
QTLSGMIHNFTQFIWVRIGLGIGEAPMNPCGVKVINDWFNIKHRGMPMGIFNAASTIGLA
ISPPILTAMMLAFGWRGMFITIGVLGIALSLGWYMLYRNRQDIDLSAQEQAYLNAGSVSA
RREPMNFREWRSLFRNRTMWGMMIGFSGINYTAWLYLAWLPGYLQTTYHLDLKSTGLMSA
IPFLFGAAGMLSNGFVTDFLVRRGMVPLKSRKICIVAGMLLSASFTAIVPQATTTYSAVV
LIGMALFCIHFAGTSCWGLIHVAVTSRMTASVGSIQNFASFIFASFAPVITGFILDTTHS
FKLALILCACFTVIGALSYLFVVKHPIVDNAA
NT seq
1359 nt
NT seq
+upstream
nt +downstream
nt
atggaaagaaccaccaccgttgacagcggaaaagaacagattgacccttattcagaccac
atcattccgatgccgccaaacggtctgctggtacgttcggcgagaattaaaaaaatccag
accaccgccatgctgttgttgtttttcgccgccatcatcaacttccttgaccgcagttcg
ctttcggtcgcgaactccaccatccgggaggaaatgggcctgagcggcaccgaaatcggc
ctgctgctttcggcgttttcattggcttacggcatcgcccaactgccctgcggattgctg
ctggatcgcaagggcccgcgcattatgctgggagtgggaatgttcgtctggtcagtgttc
cagacgctgtccggcatgatccacaatttcacccagtttatctgggtacgcatcgggctg
gggatcggcgaagcgccgatgaacccgtgcggcgtgaaggtgatcaacgactggttcaat
atcaaacaccgtggcatgccgatggggatcttcaatgcggcatccaccattggcctggcg
atcagcccgccgatcctcaccgccatgatgctggctttcggttggcgcgggatgttcatc
accatcggcgtgctggggatcgcgctgtcactcgggtggtatatgctgtatcgcaaccgc
caggacatcgacctgagcgcccaggagcaggcctatctgaatgccggcagcgtcagcgcg
cggcgcgaaccgatgaacttccgcgagtggcgctcgttattcaggaaccgcaccatgtgg
ggcatgatgatcggttttagcggcatcaactacaccgcgtggttgtatctggcctggctg
ccgggctatctgcaaaccacctatcatctggatctgaaaagcaccgggctgatgagcgcc
attccgttcctgttcggcgccgccggcatgttgtcgaacggctttgtcaccgacttcctg
gtgcgccgtggcatggtcccgctgaaaagccgcaaaatctgcatcgtggccggcatgttg
ctgtccgcgtccttcaccgccattgtgccgcaggccaccaccacctacagcgccgtagtg
ctgatcggcatggcgctgttttgcatccactttgccggtacctcctgctggggcctgatc
cacgtggcggtgacctcgcgcatgaccgcctcggtcggcagcattcagaacttcgccagc
tttattttcgcctcgttcgccccggtgatcaccggctttatcctggacaccacccactcg
tttaaactggcgcttatcctttgcgcctgcttcaccgtcatcggcgcgctatcgtatctg
ttcgtggtcaaacacccgattgtcgacaacgcggcctga
DBGET
integrated database retrieval system