KEGG   Serratia inhibens: Q5A_007070
Entry
Q5A_007070        CDS       T04576                                 
Symbol
lgoT_1
Name
(GenBank) putative L-galactonate transporter
  KO
K23016  MFS transporter, ACS family, L-galactonate transporter
Organism
sply  Serratia inhibens
Brite
KEGG Orthology (KO) [BR:sply00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sply02000]
    Q5A_007070 (lgoT_1)
Transporters [BR:sply02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    Q5A_007070 (lgoT_1)
SSDB
Motif
Pfam: MFS_1 OATP 3HCDH
Other DBs
NCBI-ProteinID: ANS41883
LinkDB
Position
complement(1487106..1488464)
AA seq 452 aa
MERTTTVDSGKEQIDPYSDHIIPMPPNGLLVRSARIKKIQTTAMLLLFFAAIINFLDRSS
LSVANSTIREEMGLSGTEIGLLLSAFSLAYGIAQLPCGLLLDRKGPRIMLGVGMFVWSVF
QTLSGMIHNFTQFIWVRIGLGIGEAPMNPCGVKVINDWFNIKHRGMPMGIFNAASTIGLA
ISPPILTAMMLAFGWRGMFITIGVLGIALSLGWYMLYRNRQDIDLSAQEQAYLNAGSVSA
RREPMNFREWRSLFRNRTMWGMMIGFSGINYTAWLYLAWLPGYLQTTYHLDLKSTGLMSA
IPFLFGAAGMLSNGFVTDFLVRRGMVPLKSRKICIVAGMLLSASFTAIVPQATTTYSAVV
LIGMALFCIHFAGTSCWGLIHVAVTSRMTASVGSIQNFASFIFASFAPVITGFILDTTHS
FKLALILCACFTVIGALSYLFVVKHPIVDNAA
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggaaagaaccaccaccgttgacagcggaaaagaacagattgacccttattcagaccac
atcattccgatgccgccaaacggtctgctggtacgttcggcgagaattaaaaaaatccag
accaccgccatgctgttgttgtttttcgccgccatcatcaacttccttgaccgcagttcg
ctttcggtcgcgaactccaccatccgggaggaaatgggcctgagcggcaccgaaatcggc
ctgctgctttcggcgttttcattggcttacggcatcgcccaactgccctgcggattgctg
ctggatcgcaagggcccgcgcattatgctgggagtgggaatgttcgtctggtcagtgttc
cagacgctgtccggcatgatccacaatttcacccagtttatctgggtacgcatcgggctg
gggatcggcgaagcgccgatgaacccgtgcggcgtgaaggtgatcaacgactggttcaat
atcaaacaccgtggcatgccgatggggatcttcaatgcggcatccaccattggcctggcg
atcagcccgccgatcctcaccgccatgatgctggctttcggttggcgcgggatgttcatc
accatcggcgtgctggggatcgcgctgtcactcgggtggtatatgctgtatcgcaaccgc
caggacatcgacctgagcgcccaggagcaggcctatctgaatgccggcagcgtcagcgcg
cggcgcgaaccgatgaacttccgcgagtggcgctcgttattcaggaaccgcaccatgtgg
ggcatgatgatcggttttagcggcatcaactacaccgcgtggttgtatctggcctggctg
ccgggctatctgcaaaccacctatcatctggatctgaaaagcaccgggctgatgagcgcc
attccgttcctgttcggcgccgccggcatgttgtcgaacggctttgtcaccgacttcctg
gtgcgccgtggcatggtcccgctgaaaagccgcaaaatctgcatcgtggccggcatgttg
ctgtccgcgtccttcaccgccattgtgccgcaggccaccaccacctacagcgccgtagtg
ctgatcggcatggcgctgttttgcatccactttgccggtacctcctgctggggcctgatc
cacgtggcggtgacctcgcgcatgaccgcctcggtcggcagcattcagaacttcgccagc
tttattttcgcctcgttcgccccggtgatcaccggctttatcctggacaccacccactcg
tttaaactggcgcttatcctttgcgcctgcttcaccgtcatcggcgcgctatcgtatctg
ttcgtggtcaaacacccgattgtcgacaacgcggcctga

DBGET integrated database retrieval system