Sphingomonas sp. M1-B02: OKW87_15670 Help Entry OKW87_15670       CDS       T11063                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism spmb  Sphingomonas sp. M1-B02 Pathway spmb00190   Oxidative phosphorylation spmb01100   Metabolic pathways Module spmb_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:spmb00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     OKW87_15670  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:spmb00194]     OKW87_15670 Photosynthesis proteins [BR:spmb00194]  Photosystem and electron transport system   F-type ATPase [OT]    OKW87_15670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  UZK65925 LinkDB All DBs Position complement(3248747..3249004) Genome browser AA seq 85 aa AA seqDB search MALHFELVTPERLVRSEEVHMVVVPGTEGDFGVLEGHAPLMSTVRDGTLEIYKSSMSETP QTIRIEGGFAEVNERGLTVLAERAE NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggccctgcatttcgaactcgtcacccccgaacgcctcgtccgctccgaggaggtccat atggtcgtcgtccccggcaccgagggcgatttcggcgtgctggagggccatgcccccctg atgtccacggtccgcgacggcacgctggaaatctacaagagctcgatgagcgagaccccc cagacgatccgcatcgaaggcggcttcgccgaggtcaacgagcgcggcctgaccgtgctc gcagagcgcgccgagtaa

DBGET integrated database retrieval system