Sphingobium sp. MI1205: K663_05720 Help Entry K663_05720        CDS       T04383                                  Name (GenBank) molecular chaperone GroES   KO K04078   chaperonin GroES Organism spmi  Sphingobium sp. MI1205 Brite KEGG Orthology (KO) [BR:spmi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:spmi03110]     K663_05720    03029 Mitochondrial biogenesis [BR:spmi03029]     K663_05720 Chaperones and folding catalysts [BR:spmi03110]  Heat shock proteins   HSP10    K663_05720 Mitochondrial biogenesis [BR:spmi03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     K663_05720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  AMK17529 LinkDB All DBs Position 1:1196354..1196641 Genome browser AA seq 95 aa AA seqDB search MAFRPLHDRVLVRRVEAEEKTAGGIIIPDTAKEKPQEGEIVAVGTGSKAEDGKVTPLDVK AGDRILFGKWSGTEVKVDGEDLLIMKESDILGVVA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcatttcgtccgttgcatgaccgcgttctcgtccgccgcgtagaggcagaagagaag accgcgggtggcatcatcatccccgacaccgccaaggaaaaaccgcaggaaggcgagatc gtcgctgtcggcaccggctcgaaggccgaagacggcaaggtgacgccgctggacgtcaag gctggcgaccgcatcctgttcggcaagtggtcgggcaccgaggtcaaggtcgatggtgaa gacctgctgatcatgaaggaatcggacattctgggcgttgtcgcctaa

DBGET integrated database retrieval system