Sphingobium sp. MI1205: K663_07230 Help Entry K663_07230        CDS       T04383                                  Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism spmi  Sphingobium sp. MI1205 Brite KEGG Orthology (KO) [BR:spmi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:spmi03032]     K663_07230    03036 Chromosome and associated proteins [BR:spmi03036]     K663_07230    03400 DNA repair and recombination proteins [BR:spmi03400]     K663_07230 DNA replication proteins [BR:spmi03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     K663_07230 Chromosome and associated proteins [BR:spmi03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     K663_07230 DNA repair and recombination proteins [BR:spmi03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       K663_07230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 DUF2267 Motif Other DBs NCBI-ProteinID:  AMK17827 UniProt:  A0A126R6Q3 LinkDB All DBs Position 1:1510913..1511185 Genome browser AA seq 90 aa AA seqDB search MNKQDLISAVAESSGLSKSDASKAVEGVFDAISASLKKGDEVRLVGFGTFSVSQRKASTG RNPRTGETMTIKASTQPKFKAGKGLKDSVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagcaggatttgatcagtgctgttgctgaaagcagcggccttagcaagagcgac gccagcaaggccgttgaaggtgtgtttgatgcgatttccgcatcgctgaagaagggcgat gaagtccgcctggttggctttggcactttctcggtctcccagcgcaaggcgtctaccggc cgcaatccgcgtacgggcgaaacgatgacgatcaaggcttccactcagccaaagttcaag gcgggcaagggcctcaaggattcagtgaactaa

DBGET integrated database retrieval system