Sphingomonas sp. NIBR02145: O3305_02895 Help Entry O3305_02895       CDS       T10953                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spnb  Sphingomonas sp. NIBR02145 Pathway spnb01100   Metabolic pathways spnb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spnb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     O3305_02895    00074 Mycolic acid biosynthesis     O3305_02895   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     O3305_02895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WHU03570 LinkDB All DBs Position 622237..622485 Genome browser AA seq 82 aa AA seqDB search MATQEEITTRVTALVVDHLGVDAGDVSPTASFIDDLGADSLDIVELVMAFEEEFGVEIPD DAAEKISTVGDAVSYISEHQAG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccactcaggaagagatcaccacccgcgtgactgcgctcgtcgtcgatcacctcggt gtcgacgcaggcgacgtttcgccgacggcgagcttcattgatgacctgggcgccgacagc ctcgacatcgtcgagctggtgatggcgttcgaagaggaattcggtgtcgagatccccgac gacgcggctgagaagatcagcaccgtcggcgacgcggtctcctacatctccgagcatcag gcgggctga

DBGET integrated database retrieval system