KEGG   Streptococcus pneumoniae SPN034156 (serotype 3): SPN034156_08090
Entry
SPN034156_08090   CDS       T02628                                 
Symbol
coaD
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
spne  Streptococcus pneumoniae SPN034156 (serotype 3)
Pathway
spne00770  Pantothenate and CoA biosynthesis
spne01100  Metabolic pathways
spne01240  Biosynthesis of cofactors
Module
spne_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:spne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SPN034156_08090 (coaD)
Enzymes [BR:spne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     SPN034156_08090 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig Pantoate_ligase
Other DBs
NCBI-ProteinID: CCP36478
LinkDB
Position
complement(828377..828865)
AA seq 162 aa
MSDKIGLFTGSFDPMTNGHLDMIERASRLFDKLYVGIFFNPHKQGFLPLENRKRGLEKAV
KHLGNVKVVSSHDKLVVDVAKRLGATCLVRGLRNASDLQYEASFDYYNHQLSSDIETIYL
HSRPEHLYISSSGVRELLKFGQDIACYVPESILEEIRNEKKD
NT seq 489 nt   +upstreamnt  +downstreamnt
atgtcagataagattggcttattcacaggctcatttgatccgatgacaaatgggcatctg
gatatgattgaacgggcgagcagactctttgataagctttatgtgggtattttttttaat
ccccacaaacaaggatttctccctcttgaaaatcgtaaacgggggttagaaaaggctgtg
aaacatttgggaaatgttaaagtcgtgtcttctcatgataaattggtggtcgatgtcgca
aaaagactgggggctacttgcctagtgcgaggcttgagaaatgcgtcggatttgcaatat
gaagccagttttgattactacaatcatcagctgtcttctgatatagagactatttattta
catagtcgacctgaacatctctatatcagttcatcaggcgttagagagcttttgaagttt
ggtcaggatattgcctgctatgttcccgagagtattttggaggaaataagaaatgaaaaa
aaagattag

DBGET integrated database retrieval system