Acidilutibacter cellobiosedens: EQM13_08225
Help
Entry
EQM13_08225 CDS
T05805
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
spoa
Acidilutibacter cellobiosedens
Pathway
spoa00770
Pantothenate and CoA biosynthesis
spoa01100
Metabolic pathways
spoa01240
Biosynthesis of cofactors
Module
spoa_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
spoa00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
EQM13_08225
Enzymes [BR:
spoa01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
EQM13_08225
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
HBD
ApbA_C
Motif
Other DBs
NCBI-ProteinID:
QAT61566
UniProt:
A0A410QC29
LinkDB
All DBs
Position
1719463..1719942
Genome browser
AA seq
159 aa
AA seq
DB search
MKVIYPGSFDPVTNGHLDIIERCSKKFERVTVAVLNNNAKNTLFTVEERKDMLKEVVRKY
NNVEVDSFSGLLIDYAKEKGIFTVVRGLRVISDFEYEMQMSLINKKLCKDIETIMMVSDS
RYSFLSSSVVKEIAEFGGDISCLVPKNVEKELVKKIKRR
NT seq
480 nt
NT seq
+upstream
nt +downstream
nt
atgaaagtaatatatcctggaagttttgatcctgtaacaaacggacatttagatataata
gaacgatgttcgaaaaaatttgaaagagtaacagtggcggtacttaataacaatgccaag
aacaccctttttacggttgaagaaaggaaggacatgctaaaagaggtagtacgtaagtac
aataatgttgaggttgatagtttttcagggcttctcattgattatgcaaaagagaaggga
atatttactgttgtcagaggattaagagtgatttctgattttgaatatgagatgcagatg
tcccttattaataaaaaattgtgcaaggatatagagactataatgatggtttcggatagc
agatattcatttttgagttcaagcgtagtcaaggagattgcagaatttggaggagatatt
tcctgtttggttcctaaaaatgtggaaaaggaattagtgaaaaaaataaaaaggaggtaa
DBGET
integrated database retrieval system