Acidilutibacter cellobiosedens: EQM13_08270 Help Entry EQM13_08270       CDS       T05805                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spoa  Acidilutibacter cellobiosedens Pathway spoa01100   Metabolic pathways spoa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spoa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EQM13_08270 (acpP)    00074 Mycolic acid biosynthesis     EQM13_08270 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EQM13_08270 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Guanylate_cyc BpuJI_N PP-binding_2 DUF7080 DUF1493 HLH Motif Other DBs NCBI-ProteinID:  QAT61575 UniProt:  A0A410QC57 LinkDB All DBs Position 1727072..1727314 Genome browser AA seq 80 aa AA seqDB search MFMVLEKLKKIISEQFDIDEENITMDSSFQDDLNADSLDLVELIMAIEDEFDLEVDDDEV DKIKTVGDAVEYIQKTTDLE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atttttatggtgcttgagaaattaaaaaagattatttcagaacaatttgatattgatgaa gaaaacataactatggattcttcttttcaagatgatttaaatgcagattcattggattta gtggaacttataatggccatagaggatgaatttgatctggaagttgatgacgatgaggtt gataaaataaaaaccgtcggagatgcagtggagtatattcaaaaaacgactgatttagag taa

DBGET integrated database retrieval system