Acidilutibacter cellobiosedens: EQM13_14920 Help Entry EQM13_14920       CDS       T05805                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism spoa  Acidilutibacter cellobiosedens Brite KEGG Orthology (KO) [BR:spoa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:spoa03032]     EQM13_14920    03036 Chromosome and associated proteins [BR:spoa03036]     EQM13_14920    03400 DNA repair and recombination proteins [BR:spoa03400]     EQM13_14920 DNA replication proteins [BR:spoa03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     EQM13_14920 Chromosome and associated proteins [BR:spoa03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     EQM13_14920 DNA repair and recombination proteins [BR:spoa03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       EQM13_14920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-DNA_bdg Peptidase_C80 DUF2267 Rapsyn_N VWA_3 Motif Other DBs NCBI-ProteinID:  QAT62764 UniProt:  A0A410QG08 LinkDB All DBs Position complement(3094907..3095185) Genome browser AA seq 92 aa AA seqDB search MNKAELVSSIAEKSNLTKKDTENALNAFMKVVEEALAKGDKVQLVGFGTFEVRERKAREG RNPRNPEEVIQIPASKAPVFKAGKALKEIVNK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaagctgaattagtttccagcatagctgaaaaaagtaatttgacaaagaaggac acagagaatgctttaaatgcatttatgaaggtagtggaggaagctctggcaaaaggagat aaggttcaattagttggttttggaacttttgaagtaagagaaagaaaagccagagaagga aggaatccaaggaatcctgaagaagttattcaaattccagcctcaaaagctccagtgttt aaagctggcaaggcattaaaagaaatagtgaataagtaa

DBGET integrated database retrieval system