Streptomyces poriferorum: P8A21_04230 Help Entry P8A21_04230       CDS       T10937                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism spof  Streptomyces poriferorum Pathway spof00261   Monobactam biosynthesis spof01100   Metabolic pathways spof01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spof00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     P8A21_04230  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:spof01008]     P8A21_04230 Polyketide biosynthesis proteins [BR:spof01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     P8A21_04230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WLQ46761 LinkDB All DBs Position 1046930..1047145 Genome browser AA seq 71 aa AA seqDB search MTNPFDDQDGTFLVLVNDENQHSLWPQFADVPAGWTVVHGPDSQASCLEHVERSWTDMRP KSLADAMNAQR NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccccttcgacgaccaggacggcaccttcctcgtcctcgtcaacgacgagaac cagcactcgctctggccgcagttcgcggacgtcccggccggctggaccgtcgtccacggc cccgactcccaggcctcctgcctggagcacgtcgagcggtcctggaccgacatgcggccc aagagcctcgccgacgccatgaacgcccagcggtag

DBGET integrated database retrieval system