Sphingopyxis sp. OPL5: EEB18_000475
Help
Entry
EEB18_000475 CDS
T10726
Name
(GenBank) phosphate ABC transporter ATP-binding protein
KO
K02036
phosphate transport system ATP-binding protein [EC:
7.3.2.1
]
Organism
spog Sphingopyxis sp. OPL5
Pathway
spog02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
spog00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
EEB18_000475
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
spog02000
]
EEB18_000475
Enzymes [BR:
spog01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.1 ABC-type phosphate transporter
EEB18_000475
Transporters [BR:
spog02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphate transporter
EEB18_000475
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
SMC_N
RsgA_GTPase
nSTAND1
AAA_22
AAA_15
AAA_33
AAA_29
AAA_28
AAA_23
AAA_30
AAA_18
Rad17
AAA_16
RNA_helicase
NACHT
PRK
Motif
Other DBs
NCBI-ProteinID:
QNO27515
LinkDB
All DBs
Position
112008..112790
Genome browser
AA seq
260 aa
AA seq
DB search
MTQEDLTILDPKMKAQGVNVFYGEKQAINDVSIDVGTDLVTAFIGPSGCGKSTFLRSLNR
MNDTVASAKVTGRIELDGEDIYAPSMDVVQLRARVGMVFQKPNPFPKSIYDNVGYGPRIH
GLAPNKADLDVVVERALVRAGLWDEVKDRLGESGTALSGGQQQRLCIARAIAVDPEVILM
DEPCSALDPIATAKIEELIHELRGRFAIVIVTHNMQQAARVSQRTAFFHLGTLVEYGKTT
DIFTNPKQERTKDYITGRYG
NT seq
783 nt
NT seq
+upstream
nt +downstream
nt
atgacccaagaagacctcacgattctcgatcccaagatgaaggcgcagggcgtcaacgtc
ttctatggggagaaacaggcgatcaacgacgtgtcgatcgacgtcggcaccgacctggtc
accgccttcatcggcccgtcgggctgcggcaagtcgaccttcctgcgctcgctgaaccgc
atgaacgacacggtcgccagcgccaaggtgaccggccgcatcgaactcgacggcgaggac
atctatgcgccgtcgatggacgtcgtgcagctgcgcgcgcgcgtcggcatggtgttccag
aaaccgaacccctttcccaagtcgatctatgacaatgtcggctatggcccgcgcatccac
ggcctcgcgccgaacaaggccgatctcgacgtcgtcgtcgaacgcgcgctggtccgcgcc
ggcctgtgggacgaggtcaaggaccggctcggcgaaagcggcaccgcgctgtcgggcggc
cagcagcagcgcctgtgcatcgcgcgcgcgatcgcggtcgatcccgaagtcatcctgatg
gacgagccctgctcggcgctcgacccgatcgcgaccgccaagatcgaggagctgatccac
gaattgcgcggccgtttcgcgatcgtgatcgtcacccacaacatgcagcaggcggcccgc
gtgtcgcagcgcaccgctttcttccacctcgggacgctggtcgaatatggcaagaccacc
gacatcttcaccaacccgaagcaggaacgcaccaaggactatatcaccggccgctacggc
taa
DBGET
integrated database retrieval system