Sporosarcina sp. ANT_H38: GGGNBK_07230
Help
Entry
GGGNBK_07230 CDS
T10925
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
spoh Sporosarcina sp. ANT_H38
Pathway
spoh00770
Pantothenate and CoA biosynthesis
spoh01100
Metabolic pathways
spoh01240
Biosynthesis of cofactors
Module
spoh_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
spoh00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
GGGNBK_07230 (coaD)
Enzymes [BR:
spoh01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
GGGNBK_07230 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID:
XKI11422
LinkDB
All DBs
Position
1508131..1508613
Genome browser
AA seq
160 aa
AA seq
DB search
MSKIAVVPGSFDPLTNGHLDIIKRAARVFGDVRVAVMNNSSKNSLFTVEERIALIAEVTS
VFPNVRVESSSGLLVDYAKSVGASVIVRGLRAVSDFEYEMQITSMNRFLDESIETFFIMT
NNQYSFLSSSIVKEVAKYGGEISGLVPIQVEEALRKKYKA
NT seq
483 nt
NT seq
+upstream
nt +downstream
nt
atgtcgaaaattgcagttgtgcctggtagttttgatccgctgacgaatggacatcttgat
attatcaaaagagcggcaagagttttcggtgatgttagggtcgctgtcatgaataactca
tcgaagaattcactttttactgttgaagagcgtatagcacttattgcagaggtgacgtct
gtgtttcctaacgtgagagtagagtcatcttctggattacttgtggattatgccaaaagt
gtcggggcttctgtaatcgttcgtggattgcgtgctgtatcggattttgagtatgaaatg
cagattacttccatgaaccggtttctcgatgaaagtatagagacgtttttcatcatgacg
aacaatcagtattcattcctcagttcgagcattgtcaaagaggtggcaaagtacggaggc
gaaatctcaggacttgtgccgattcaagttgaagaggcattgagaaagaaatacaaagcg
taa
DBGET
integrated database retrieval system