Spongiibacter sp. IMCC21906: IMCC21906_00783 Help Entry IMCC21906_00783   CDS       T03945                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism spoi  Spongiibacter sp. IMCC21906 Brite KEGG Orthology (KO) [BR:spoi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:spoi03036]     IMCC21906_00783 Chromosome and associated proteins [BR:spoi03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     IMCC21906_00783 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Phage_rep_O SOGA1-2-like_CC bZIP_1 Syntaxin TSC22 YabA SWIRM-assoc_1 Motif Other DBs NCBI-ProteinID:  AKH68475 UniProt:  A0A0F7LYU6 LinkDB All DBs Position complement(832107..832316) Genome browser AA seq 69 aa AA seqDB search MDDRQLQLLERKIEELIQLCEQLDKENRSFKTEKQNWKIEREQLIEKTDTARAKVESMIQ RLRALEKEA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggacgaccgtcaattacagctgctagaacgaaaaatagaagagctgattcagctgtgc gagcaactggacaaagaaaaccgcagcttcaaaaccgaaaaacaaaactggaagatagag cgggaacagctcattgaaaaaaccgataccgctcgggccaaggttgaatccatgatccaa cggctgcgtgctctggagaaagaagcgtga

DBGET integrated database retrieval system