Spongiibacter sp. IMCC21906: IMCC21906_02085
Help
Entry
IMCC21906_02085 CDS
T03945
Name
(GenBank) DNA polymerase III, subunit gamma/tau
KO
K02343
DNA polymerase III subunit gamma/tau [EC:
2.7.7.7
]
Organism
spoi
Spongiibacter sp. IMCC21906
Pathway
spoi03030
DNA replication
spoi03430
Mismatch repair
spoi03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
spoi00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
IMCC21906_02085
03430 Mismatch repair
IMCC21906_02085
03440 Homologous recombination
IMCC21906_02085
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
spoi03032
]
IMCC21906_02085
03400 DNA repair and recombination proteins [BR:
spoi03400
]
IMCC21906_02085
Enzymes [BR:
spoi01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.7 DNA-directed DNA polymerase
IMCC21906_02085
DNA replication proteins [BR:
spoi03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
DNA polymerase III holoenzyme
IMCC21906_02085
DNA repair and recombination proteins [BR:
spoi03400
]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
DNA polymerase III holoenzyme
IMCC21906_02085
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DNA_pol3_delta2
DNA_pol3_gamma3
DNAX_ATPase_lid
DNA_pol3_tau_5
AAA
RuvB_N
AAA_22
AAA_5
AAA_18
AAA_14
AAA_16
ResIII
AAA_30
AAA_2
Rad17
AAA_19
nSTAND3
TsaE
AAA_28
AAA_7
PIF1
Mg_chelatase
SKI
DnaI_N
Herpes_Helicase
zf-CXXC
Motif
Other DBs
NCBI-ProteinID:
AKH69755
LinkDB
All DBs
Position
complement(2239233..2241416)
Genome browser
AA seq
727 aa
AA seq
DB search
MSYQVLARKWRPKSFREMAGQNHVLKALINALDHDRLHHAYLFTGTRGVGKTTIARILAK
CLNCETGVSSEPCGQCQSCVAINEGRFVDLIEVDAASRTKVEDTRELLDNVQYTPSQGRY
KVYLIDEVHMLSSSSFNALLKTLEEPPPHVKFLLATTDPQKIPPTILSRCLQFSLKNLSP
EKVVEYLKIVLEKEMIQYDDGALWLLGRAADGSMRDALSLTDQGIAFGSGKLSEPEIRQM
LGTIDHDAVYRLIAALNERSASLVLQTIADTLELGVDPAGVVDELLSVLHRLALAQLVPD
GIDNSLGDKQRLLDLAGSLPAEDVQFFYQMALAGRRDFGLSPDPRAALEMLLLRMLAFMP
AGVAHPPQRALPGDQLAAEAAASAKKPEPNRREAMVSQSPNQGMSSQSISNQDISDQGSD
EPAAVSQVASPAQTAAPEQTAPAPQASTPSPASPAQTSASPVSLASTSEPSVELGSSSDE
LPPWEEYNSSSHHVATPPLSGADAARQALSATITTETKEEEQGAFEPDVPPLGELHQQHS
ASKPDSIARPSAAPPQTESLAESMKAPPAAPMEAVAPSSSSDEVYTSPLSWDELNTTSWR
EQFSRFKLPGMLGSVASHCQIQSLGEGHINFCIHQSNAALLNSRHIERLAESLSTYFERQ
IQVKIDIGEVAEETPAAYRQRQLEQRLHETTQAILGDPVVQQLMTDFNAELEDGSVKLGE
YQEKRGR
NT seq
2184 nt
NT seq
+upstream
nt +downstream
nt
atgagctatcaggtattggcgcgaaagtggcgcccgaaaagttttcgtgaaatggcgggc
caaaatcatgtcttgaaggcattgatcaacgcgctggatcatgaccgcctgcatcacgcc
tacctttttacgggtactcgcggcgtgggcaaaaccaccatcgcacggatcttggccaag
tgcctgaattgcgaaaccggcgttagttcagaaccctgtggccagtgtcagtcgtgtgta
gcgattaacgaaggccgctttgtcgacctgattgaagtggatgcagcatctcgtaccaag
gtagaagatacccgcgagctgttagataacgtccaatacaccccaagccaaggccgctat
aaggtctaccttatagacgaagtgcacatgctgagtagcagcagttttaatgccttgttg
aagaccttggaagagccaccgccacacgttaaatttttattagctactaccgatccgcaa
aaaattccgccgactattttatctcgttgtcttcagttttcgctgaaaaacttgagtcca
gaaaaagtggtcgaatacctcaaaatcgtactcgaaaaggaaatgattcagtacgatgac
ggtgcgctttggctgttgggacgagctgcagatggcagtatgcgggatgctttgagcttg
acggatcaaggtatcgcctttggttcgggcaagttatctgagccagaaattcggcagatg
ctgggcacaatagaccacgatgcggtttatcgcttaattgcggcccttaatgagcggagc
gcatcattggttttgcaaaccattgccgacaccttggagctgggcgtggacccggcaggg
gtggttgatgaactgcttagcgttcttcatcgtcttgcattggcacagcttgtccccgat
ggcattgataacagcttgggtgataaacaacgattgctggaccttgctggtagtttgccc
gctgaagatgtgcagtttttttatcaaatggcgctggcaggtcggcgagattttggtttg
tcgccagatcctagggcggcattagagatgctgttgctacggatgttggcctttatgcca
gctggcgttgctcacccgccacagcgggcattacccggcgatcagcttgcagcggaggct
gctgcatcggcaaaaaagccggagcctaatcgccgggaggcgatggtgtcccaaagccca
aatcaaggcatgtcgagccaaagtatatcgaaccaagacatatcggatcagggttctgat
gagccagcggctgtttctcaggttgcttctccagcccagaccgcagcgccagaacaaact
gctccagccccccaagcgtcgacgccaagccccgcatcgcctgcgcaaacctctgcgtca
ccggtgtcacttgcgtcgacttctgagccctcggtcgagctgggttcatcttccgacgaa
ctgccgccttgggaagaatacaattcttcgtctcatcatgtcgcaacaccgccattgtct
ggggctgatgccgctcgacaggctttgtcagcgaccatcacaacagagaccaaagaagaa
gagcagggcgcctttgagccggatgttcccccgttgggtgaattgcatcagcagcattct
gcgtcaaagcctgacagcatagctcggccatcagctgcgcctcctcaaacagaatcttta
gctgagtccatgaaagcgccgccagctgcaccgatggaggctgtggctccgtcttcatca
agcgatgaggtatatacgtcacccttgtcttgggatgaattaaacactaccagttggcgt
gagcagtttagccgctttaaactgccgggcatgctgggcagtgtcgcctcgcactgccag
attcaaagtctcggtgaagggcatatcaatttttgtatccatcaatctaacgccgccttg
ttgaattcacgtcatatcgagcgactggctgagtcattaagtacgtattttgaacgccaa
atacaggttaaaattgatattggtgaggttgctgaagaaacgcctgcggcctaccggcag
cggcagcttgaacaacgtttgcatgaaaccacgcaggcaatactgggtgatccggttgtc
caacaattaatgacagattttaacgccgagctggaagatggctcagtaaaactcggtgaa
tatcaggagaagagaggacgatga
DBGET
integrated database retrieval system