Shewanella polaris: FH971_01585 Help Entry FH971_01585       CDS       T06579                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spol  Shewanella polaris Pathway spol01100   Metabolic pathways spol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FH971_01585    00074 Mycolic acid biosynthesis     FH971_01585   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FH971_01585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDE29774 UniProt:  A0A4Y5YAP4 LinkDB All DBs Position complement(359184..359432) Genome browser AA seq 82 aa AA seqDB search MQNREQILEMLSGILVEEFEIEATDITLEASLYEDLDLDSIDAVDLVIKLQQLTGKKIQP EAFKTVRSVSDVVNAIEGLIKS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaaatcgtgaacaaatccttgagatgcttagtggtattttagttgaagagtttgaa atagaagcgacagatatcactctagaagcttctttgtatgaagatctagatttagacagt attgatgcggtagatttggtgattaaattgcaacagctgacgggtaaaaaaattcagcca gaagcatttaaaaccgtacgttcagtgagcgatgtcgttaatgctattgaaggcttaatt aaaagctaa

DBGET integrated database retrieval system