Shewanella polaris: FH971_01590 Help Entry FH971_01590       CDS       T06579                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spol  Shewanella polaris Pathway spol01100   Metabolic pathways spol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FH971_01590    00074 Mycolic acid biosynthesis     FH971_01590   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FH971_01590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDE29775 UniProt:  A0A4Y5YAT1 LinkDB All DBs Position complement(359441..359695) Genome browser AA seq 84 aa AA seqDB search MNLHNQIKQLIIDCLDLEDVTVDDIETDAALFGDGLGLDSIDALELGLAIKKEFDVKIEA NSDATKAHFFSVASLASFIESQRV NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaacttacacaatcaaattaaacaactgatcattgattgcttagatctagaagatgtt acagtcgatgatatcgaaactgatgcggccttatttggcgatggtctgggtttagattca atcgatgcgcttgaattaggcttggcgataaagaaagagtttgatgtcaaaattgaagcc aattctgatgcgactaaagcacactttttcagtgttgctagcttagctagctttattgaa tctcaacgtgtttag

DBGET integrated database retrieval system