Shewanella polaris: FH971_04275 Help Entry FH971_04275       CDS       T06579                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism spol  Shewanella polaris Pathway spol00190   Oxidative phosphorylation spol01100   Metabolic pathways Module spol_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:spol00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     FH971_04275  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:spol00194]     FH971_04275 Photosynthesis proteins [BR:spol00194]  Photosystem and electron transport system   F-type ATPase [OT]    FH971_04275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Voltage_CLC DUF5702 DUF4220 Motif Other DBs NCBI-ProteinID:  QDE30254 UniProt:  A0A4Y5YC49 LinkDB All DBs Position complement(980772..981053) Genome browser AA seq 93 aa AA seqDB search MDSITIIAMVSIITAGLTITIGVIGPSLAEGKAVATALSALAQQPDASATITRTLLVGLA MIESTAIYCFVVSMILLFANPFWNYFIDLAAGI NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggacagcataacaattattgcaatggtatcgattatcaccgcaggattaaccatcact atcggcgttattggaccgtcattagccgaaggcaaggcagttgcaacggcattatctgca ttagcccaacaacctgatgcatctgccactatcactcgtaccctgcttgtcggcttggcg atgatagaatccactgcaatttattgctttgttgtatcgatgattttgttgtttgccaat ccattttggaattactttatcgacctagctgcaggtatataa

DBGET integrated database retrieval system