Shewanella polaris: FH971_12065 Help Entry FH971_12065       CDS       T06579                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spol  Shewanella polaris Pathway spol01100   Metabolic pathways spol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FH971_12065 (acpP)    00074 Mycolic acid biosynthesis     FH971_12065 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FH971_12065 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB EutQ DUF7966 DUF1896 Motif Other DBs NCBI-ProteinID:  QDE31637 UniProt:  A0A4Y5YG66 LinkDB All DBs Position complement(2769803..2770036) Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIIIEQLGVKEEDVKSAASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVSKNQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgtgtaaagaaaatcatcattgagcaacttggcgttaaagaa gaagacgttaaatcagctgcttcttttgtagacgatttaggtgccgattctctagacact gttgaattggttatggctctagaagaagagtttgataccgagatccctgacgaagaagct gaaaagatcactactgttcaagcagcgatcgattacgtttctaaaaatcagtaa

DBGET integrated database retrieval system