Flagellimonas maritima: HME9304_01580 Help Entry HME9304_01580     CDS       T05505                                  Name (GenBank) ATP synthase subunit   KO K02110   F-type H+-transporting ATPase subunit c Organism spon  Flagellimonas maritima Pathway spon00190   Oxidative phosphorylation spon01100   Metabolic pathways Module spon_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:spon00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     HME9304_01580  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:spon00194]     HME9304_01580 Photosynthesis proteins [BR:spon00194]  Photosystem and electron transport system   F-type ATPase [OT]    HME9304_01580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AWX44577 UniProt:  A0A2Z4LTG4 LinkDB All DBs Position 1758015..1758206 Genome browser AA seq 63 aa AA seqDB search MEIPVMVGAGLVVIGVGMGIGRIGGSAMDAIARQPEAYGKIQTAMLIAAALIEGIGFAAL FAV NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggaaattccagtaatggtaggtgcaggtttagtagttattggtgttggtatgggtatt ggtagaatcggtggttctgcaatggatgccatagcacgtcagcctgaagcttacggaaaa atccaaacagcgatgttgattgcagcagcgttgattgaaggaattggttttgctgcactt tttgcagtgtaa

DBGET integrated database retrieval system