Sporosarcina sp. P33: SporoP33_14675 Help Entry SporoP33_14675    CDS       T04790                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism spor  Sporosarcina sp. P33 Pathway spor02024   Quorum sensing spor03018   RNA degradation Brite KEGG Orthology (KO) [BR:spor00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     SporoP33_14675  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     SporoP33_14675  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:spor03019]     SporoP33_14675    03036 Chromosome and associated proteins [BR:spor03036]     SporoP33_14675 Messenger RNA biogenesis [BR:spor03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      SporoP33_14675 Chromosome and associated proteins [BR:spor03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     SporoP33_14675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  ARD49371 LinkDB All DBs Position 3028740..3028964 Genome browser AA seq 74 aa AA seqDB search MAQGNMQDTFLNSLRKNNTFVTIFLLNGFQLKGLIKSYDNYTVLLESEGKQQLIYKHAIS TYAPSKPVILKDEQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcacaaggaaacatgcaagatacttttttaaattcattacgcaagaacaacacattt gtaacaatctttttactcaatggttttcagttgaaaggtctgatcaagtcatatgacaat tatacggtcctgctggaatcagaaggcaaacagcagctgatctataaacatgcgatctca acttatgctccttcaaaaccagttatcttaaaagatgaacaataa

DBGET integrated database retrieval system