Sulfitobacter pontiacus: G6548_02575 Help Entry G6548_02575       CDS       T06732                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism spot  Sulfitobacter pontiacus Brite KEGG Orthology (KO) [BR:spot00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:spot03032]     G6548_02575    03036 Chromosome and associated proteins [BR:spot03036]     G6548_02575    03400 DNA repair and recombination proteins [BR:spot03400]     G6548_02575 DNA replication proteins [BR:spot03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     G6548_02575 Chromosome and associated proteins [BR:spot03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     G6548_02575 DNA repair and recombination proteins [BR:spot03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       G6548_02575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_euk_2 DUF2267 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  QLL43771 LinkDB All DBs Position complement(557736..558011) Genome browser AA seq 91 aa AA seqDB search MTKTQLVAALAEEMGEDKKTASAALDAVCALITKEVSGGGAVTLPGIGKIYCRERPERMV RNPATGEQFKKDADKVVKMTIAKALKDSVNE NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgacaaaaacccagctcgtcgcggctttggctgaggaaatgggcgaagacaagaaaaca gcaagcgcggcactggacgcggtttgcgcgttgatcaccaaagaagtctccggcggtggc gctgtgacacttcccggcattggcaaaatctactgccgcgaacgccccgagcgtatggtg cgcaaccctgccaccggcgaacagttcaagaaagacgcggacaaggttgttaagatgacc atcgcgaaagcgctgaaagacagcgttaacgaataa

DBGET integrated database retrieval system