KEGG   Sulfitobacter pontiacus: G6548_07430
Entry
G6548_07430       CDS       T06732                                 
Name
(GenBank) multidrug effflux MFS transporter
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
spot  Sulfitobacter pontiacus
Brite
KEGG Orthology (KO) [BR:spot00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spot02000]
    G6548_07430
Transporters [BR:spot02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    G6548_07430
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-ProteinID: QLL43818
LinkDB
Position
1550096..1551310
AA seq 404 aa
MFRTALILGSICVTGPFAIDMYLPALPAIEEALDVSVSAAQITLVAYFLAYGVSQLVYGP
LSDQIGRKKTLAIGMSIFCVGAVICAVAPDIETLVLGRLVQGIGGATVMVIPRAIVRDMY
TGAQATRLMSSIMLVISVSPMLAPLAGSAVVSFGSWREIFLALAILAAATLTMAQIALPE
TLTADKRRKVNLRELSRSCGILFRDPVFVGLTFIAGFGMASFFLFISSASFVYTGQFGLT
PTEFSLAFAFNAVGFFIATQAAGRLADMWGLATLIGRGVTGFAVCSALLTGVVLAGFGTL
PVLLIGLFLAYSFLGVVVPSAMVAALDAHGRRAGMASSLSGSLTMLTGAFCIAATTPFFD
GTAVPMVVSIALCGVAALALVIFTMPKLRQQQEAAAADQMPAAA
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgttccgtaccgcccttattcttggctctatctgtgtgacaggtccttttgccatcgac
atgtatctgcctgccttgcccgcgatcgaagaggcgctggatgtctctgtctcggcggcc
cagatcacgctggtcgcctatttcctcgcctatggcgtgtcgcagctggtctatgggccg
ctgtccgaccagatcgggcgcaaaaagacccttgccatcgggatgagcattttctgcgtc
ggcgcggtgatctgcgctgtggcccccgatatcgagacgctggtgctggggcgtctggtg
cagggcatcggcggggcgacggtgatggtcattccccgtgccatcgtgcgcgatatgtac
accggtgcgcaggcgacgcggttgatgtcgtcgatcatgctggtgatttcggtctcaccc
atgctggcccccttggcgggcagcgcggtggtcagtttcggcagctggcgcgagattttc
ctcgcccttgcgatccttgcggcggcgacgttgacgatggcgcagatcgcgctgcccgag
acgctgaccgcggacaagcgccgcaaggtcaatctgcgcgagctgtcgcgcagctgtggt
atcctgtttcgcgatccggtgttcgtcggcctgacctttattgcgggtttcggcatggcg
agcttcttcttgttcatctccagcgcgtccttcgtctacaccggtcaattcgggctgacc
ccgaccgagttctcgctggccttcgcctttaacgcggtggggttctttatcgccacgcag
gcggcggggcgtctggcggatatgtgggggcttgccacgctgatcgggcgcggtgtcacc
ggctttgccgtctgctctgcgctgttgacgggcgttgtgctggccggtttcggcacgctg
ccggtgctgttgatcgggctgtttctggcctattcctttctgggggtcgttgtgccttcg
gcgatggtcgcggcacttgatgcgcatgggcggcgcgcgggtatggcgtcctcgctgagt
gggagcctgacaatgctgacgggggccttttgcatcgctgcgacgacgccgttctttgac
ggcaccgctgtgcccatggtggtgagcatcgcgctgtgtggtgtggcggcattggcgctg
gtgatctttaccatgcccaagctgcgccagcagcaggaggccgcggcggccgaccagatg
cccgccgcggcctaa

DBGET integrated database retrieval system