Sphingobium phenoxybenzoativorans: KFK14_04005 Help Entry KFK14_04005       CDS       T07582                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spph  Sphingobium phenoxybenzoativorans Pathway spph01100   Metabolic pathways spph01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spph00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KFK14_04005    00074 Mycolic acid biosynthesis     KFK14_04005   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KFK14_04005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QUT06624 UniProt:  A0A975Q295 LinkDB All DBs Position complement(807404..807646) Genome browser AA seq 80 aa AA seqDB search MTDRQNIFDSVTAQIAPFNKKEIALTETTTFAGDLEWDSLTVMDFVAAIEDEFDIIITMN MQAEIETVGQLVDAVAKLKS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacggatcgccagaacatattcgacagcgtcacggcgcagatcgcccccttcaacaag aaggagatcgcgcttaccgaaaccacgacttttgcgggcgacctggagtgggacagcctg accgtcatggatttcgtcgccgcgatcgaggatgagttcgacatcatcatcaccatgaac atgcaggcggagatcgagacggtgggccagctcgtcgatgcagtcgccaagcttaagagc tga

DBGET integrated database retrieval system