Sphingobium phenoxybenzoativorans: KFK14_11845 Help Entry KFK14_11845       CDS       T07582                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism spph  Sphingobium phenoxybenzoativorans Pathway spph00190   Oxidative phosphorylation spph01100   Metabolic pathways Module spph_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:spph00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     KFK14_11845  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:spph00194]     KFK14_11845 Photosynthesis proteins [BR:spph00194]  Photosystem and electron transport system   F-type ATPase [OT]    KFK14_11845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C SP_C-Propep Motif Other DBs NCBI-ProteinID:  QUT03852 UniProt:  A0A975Q022 LinkDB All DBs Position 2427267..2427494 Genome browser AA seq 75 aa AA seqDB search MDAEAAKLIGAGLAAIGAGMAALGVGNVFGSFLESALRNPSAADGQQGRLFIGFAAAELL GLLAFVVSMILIFVA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggacgcagaagccgcaaagctgatcggtgccggtctggctgctatcggtgccggcatg gccgcgctcggcgtgggcaacgtcttcggttctttccttgagagcgcgctgcgcaatccg tcggccgccgacggtcagcagggccgcctgttcatcggcttcgccgctgccgaacttctc ggcctgctggcgttcgttgtgtcgatgatcctgatcttcgtcgcctaa

DBGET integrated database retrieval system