Sphingobium phenoxybenzoativorans: KFK14_15390
Help
Entry
KFK14_15390 CDS
T07582
Name
(GenBank) ATP synthase F1 subunit epsilon
KO
K02114
F-type H+-transporting ATPase subunit epsilon
Organism
spph
Sphingobium phenoxybenzoativorans
Pathway
spph00190
Oxidative phosphorylation
spph01100
Metabolic pathways
Module
spph_M00157
F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:
spph00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
KFK14_15390
09180 Brite Hierarchies
09181 Protein families: metabolism
00194 Photosynthesis proteins [BR:
spph00194
]
KFK14_15390
Photosynthesis proteins [BR:
spph00194
]
Photosystem and electron transport system
F-type ATPase [OT]
KFK14_15390
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ATP-synt_DE_N
Motif
Other DBs
NCBI-ProteinID:
QUT04438
UniProt:
A0A975Q0I8
LinkDB
All DBs
Position
3113177..3113431
Genome browser
AA seq
84 aa
AA seq
DB search
MALHFELVTPEKLVRSESVYMVVVPGSEGDFGVLEGHAPFMSTVRDGEIQVFSSATAAPE
SIPVVGGFAEVNEKGLTVLAEKAG
NT seq
255 nt
NT seq
+upstream
nt +downstream
nt
atggcactgcatttcgaactcgtgaccccggaaaagctcgtccgttcggagagcgtctat
atggtcgtcgtccccggcagcgagggcgatttcggcgtgcttgaagggcatgcccccttc
atgtcgaccgttcgcgacggcgagattcaggtcttttccagcgccaccgccgcgccggag
agcattcccgtcgtcggcggtttcgccgaagtcaatgaaaagggcctgaccgtcctcgcg
gagaaggccggttga
DBGET
integrated database retrieval system