Sphingobium phenoxybenzoativorans: KFK14_15390 Help Entry KFK14_15390       CDS       T07582                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism spph  Sphingobium phenoxybenzoativorans Pathway spph00190   Oxidative phosphorylation spph01100   Metabolic pathways Module spph_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:spph00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     KFK14_15390  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:spph00194]     KFK14_15390 Photosynthesis proteins [BR:spph00194]  Photosystem and electron transport system   F-type ATPase [OT]    KFK14_15390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  QUT04438 UniProt:  A0A975Q0I8 LinkDB All DBs Position 3113177..3113431 Genome browser AA seq 84 aa AA seqDB search MALHFELVTPEKLVRSESVYMVVVPGSEGDFGVLEGHAPFMSTVRDGEIQVFSSATAAPE SIPVVGGFAEVNEKGLTVLAEKAG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcactgcatttcgaactcgtgaccccggaaaagctcgtccgttcggagagcgtctat atggtcgtcgtccccggcagcgagggcgatttcggcgtgcttgaagggcatgcccccttc atgtcgaccgttcgcgacggcgagattcaggtcttttccagcgccaccgccgcgccggag agcattcccgtcgtcggcggtttcgccgaagtcaatgaaaagggcctgaccgtcctcgcg gagaaggccggttga

DBGET integrated database retrieval system