Streptomyces profundus: K4G22_13510 Help Entry K4G22_13510       CDS       T10233                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sprf  Streptomyces profundus Pathway sprf00998   Biosynthesis of various antibiotics sprf01100   Metabolic pathways sprf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sprf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K4G22_13510    00074 Mycolic acid biosynthesis     K4G22_13510   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K4G22_13510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  UED85090 LinkDB All DBs Position complement(3143369..3143620) Genome browser AA seq 83 aa AA seqDB search MTAPVDERFGKIKEIVCEILELEEDEVTAEGLFEEYGADSLRAIEILASLEREFNVVIDQ SELAEMVNLNAVVKVVEVAIEKK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgactgcaccagttgacgagcggttcgggaagatcaaggagatcgtctgcgagatcctc gaactggaggaggacgaggtcaccgccgaggggctgttcgaggagtacggcgccgactcg ctgcgggcgatcgagatcctcgcctcccttgagcgggagttcaacgtggtgatcgaccag tccgagctggcggagatggtcaacctgaacgccgtggtcaaggtcgtcgaggtggcgatc gagaagaagtag

DBGET integrated database retrieval system