Streptomyces pristinaespiralis: SPRI_5070 Help Entry SPRI_5070         CDS       T04073                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spri  Streptomyces pristinaespiralis Pathway spri00998   Biosynthesis of various antibiotics spri01100   Metabolic pathways spri01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spri00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SPRI_5070    00074 Mycolic acid biosynthesis     SPRI_5070   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SPRI_5070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ALC23376 UniProt:  A0A0M4DF67 LinkDB All DBs Position complement(5919812..5920060) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVKGLAEIVNEIAGIPTEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDAADYIAKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacgcaggaagagatcgtcaagggtctcgccgagatcgtcaacgagatcgcc ggtatcccgaccgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccc gacgaggacgtcaagaacctgaagaccgtcggcgacgccgcggactacatcgccaagcac caggcctga

DBGET integrated database retrieval system