Streptomyces pristinaespiralis: SPRI_7076 Help Entry SPRI_7076         CDS       T04073                                  Name (GenBank) putative acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism spri  Streptomyces pristinaespiralis Pathway spri00253   Tetracycline biosynthesis spri01056   Biosynthesis of type II polyketide backbone spri01100   Metabolic pathways spri01110   Biosynthesis of secondary metabolites Module spri_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:spri00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     SPRI_7076    00253 Tetracycline biosynthesis     SPRI_7076  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:spri01004]     SPRI_7076    01008 Polyketide biosynthesis proteins [BR:spri01008]     SPRI_7076 Lipid biosynthesis proteins [BR:spri01004]  Polyketide synthase   Component type    SPRI_7076 Polyketide biosynthesis proteins [BR:spri01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      SPRI_7076     Nonaketide PKS      SPRI_7076     Decaketide PKS      SPRI_7076 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ALC25382 UniProt:  D9UBS9 LinkDB All DBs Position 8199133..8199396 Genome browser AA seq 87 aa AA seqDB search MDHLELDDLKTLLRECAGVEEGVDLDGDVLDVPFLALGYDSLALLQTTGRIERDYDVTLD EEGLDEAETPRDYLALINRALSARTAV NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggaccacctggaactggacgacctgaagaccctgctgcgcgagtgcgccggcgtcgag gaaggcgtcgacctcgacggcgacgtcctcgacgtccccttcctcgccctcggctacgac tcgctggccctgctgcagaccaccggccgcatcgaacgcgactacgacgtcaccctcgac gaggagggcctcgacgaggcggagaccccccgcgactacctggccctgatcaaccgggcc ctgtccgcgcggaccgcggtgtga

DBGET integrated database retrieval system