Streptomyces pristinaespiralis: SPRI_7088 Help Entry SPRI_7088         CDS       T04073                                  Name (GenBank) putative acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism spri  Streptomyces pristinaespiralis Pathway spri00253   Tetracycline biosynthesis spri01056   Biosynthesis of type II polyketide backbone spri01100   Metabolic pathways spri01110   Biosynthesis of secondary metabolites Module spri_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:spri00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     SPRI_7088    00253 Tetracycline biosynthesis     SPRI_7088  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:spri01004]     SPRI_7088    01008 Polyketide biosynthesis proteins [BR:spri01008]     SPRI_7088 Lipid biosynthesis proteins [BR:spri01004]  Polyketide synthase   Component type    SPRI_7088 Polyketide biosynthesis proteins [BR:spri01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      SPRI_7088     Nonaketide PKS      SPRI_7088     Decaketide PKS      SPRI_7088 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding HeH Motif Other DBs NCBI-ProteinID:  ALC25394 UniProt:  D9UBR7 LinkDB All DBs Position complement(8211809..8212063) Genome browser AA seq 84 aa AA seqDB search MTIDDLRRILVECAGEDETGSLDGDILDTPFADLGYDSLALMETAGRIKQEFGVVIADED IATVETPRVLLDTVAELSRSVAAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaccatcgatgatctccgcaggatcctcgtcgagtgcgccggtgaggacgagaccggg agcctggacggggacatcctggacaccccgttcgccgacctcggttacgactcgctggcg ctgatggagaccgcgggccggatcaagcaggagttcggtgtggtgatcgccgacgaggac atcgcgaccgtggagactccgcgggtgctgctcgacaccgtggcggagctttcgcgttcc gtcgccgccgcatga

DBGET integrated database retrieval system