Salinivibrio proteolyticus: N7E60_01515
Help
Entry
N7E60_01515 CDS
T08723
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
spro
Salinivibrio proteolyticus
Pathway
spro03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
spro00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
N7E60_01515 (rplR)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
spro03011
]
N7E60_01515 (rplR)
Ribosome [BR:
spro03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
N7E60_01515 (rplR)
Bacteria
N7E60_01515 (rplR)
Archaea
N7E60_01515 (rplR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Ribosomal_L5e
TM1506
ADH_zinc_N
CoA_binding_3
Rpf1_C
Motif
Other DBs
NCBI-ProteinID:
WBA15034
UniProt:
A0ABY7LCS3
LinkDB
All DBs
Position
301850..302203
Genome browser
AA seq
117 aa
AA seq
DB search
MDKKASRIRRATKARRKIAEMGATRLVVHRTPRHVYAQVIAGNGAEVIAAASTVEKAIRE
QVKSTGNKDAAAAVGKIIAERAKEKGIEAVAFDRSGFQYHGRVAALADAAREAGLKF
NT seq
354 nt
NT seq
+upstream
nt +downstream
nt
atggataagaaagcatctcgtatccgtcgtgcgaccaaagcacgacgcaagatcgcggaa
atgggtgcgactcgcctggtggtacaccgtactccacgtcatgtgtacgcacaggttatc
gctggtaacggcgcggaagtcatcgccgctgcttctaccgtagaaaaagcgatccgtgaa
caagttaagagcaccggtaacaaagacgccgcagcagcagtaggtaaaatcattgctgag
cgtgcgaaggaaaaaggcatcgaagctgttgcttttgaccgttccggtttccaataccac
ggccgtgtggctgcactggcagatgctgcccgtgaagctggtctgaaattctaa
DBGET
integrated database retrieval system