Sphingomonas sp. R1: OIM94_06250 Help Entry OIM94_06250       CDS       T11062                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sprr  Sphingomonas sp. R1 Pathway sprr01100   Metabolic pathways sprr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sprr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OIM94_06250    00074 Mycolic acid biosynthesis     OIM94_06250   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OIM94_06250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 RE_Bsp6I Thoc2 Motif Other DBs NCBI-ProteinID:  UYY78586 LinkDB All DBs Position complement(1308657..1308899) Genome browser AA seq 80 aa AA seqDB search MTDRAEIFDIVAAQIEPFNKKSVALSETTTFAGDLEWDSLTVMDFVAAIEDEFDIVITMN MQAEIENVGQLVDAVQKLKG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgactgaccgtgcagaaatcttcgacatcgtcgccgcgcagatcgaacccttcaacaag aagagcgtcgcgctttcggaaaccaccaccttcgccggcgatctcgaatgggacagcctg acggtgatggatttcgtcgccgcgatcgaggacgaattcgacatcgtcatcaccatgaac atgcaggccgagatcgagaatgtcggccagctggtcgacgccgtgcagaagctcaagggc tga

DBGET integrated database retrieval system