Sphingomonas sp. R1: OIM94_09455
Help
Entry
OIM94_09455 CDS
T11062
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
sprr Sphingomonas sp. R1
Pathway
sprr00770
Pantothenate and CoA biosynthesis
sprr01100
Metabolic pathways
sprr01240
Biosynthesis of cofactors
Module
sprr_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
sprr00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
OIM94_09455 (coaD)
Enzymes [BR:
sprr01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
OIM94_09455 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
GCV_T_C
Motif
Other DBs
NCBI-ProteinID:
UYY75767
LinkDB
All DBs
Position
1938714..1939223
Genome browser
AA seq
169 aa
AA seq
DB search
MHSRIGVYPGTFDPITRGHMDIIRRGAKLVDRLVIGVTTNPSKSPMFTVEERMAMVRREV
EDLGGSIEVVSFDSLLMDFAERERASVIVRGLRAVADFEYEYQMAGMNQQINDRIETVFL
MADVSLQPIASRLVKEIALYGGPIHRFVTPAVEADVAARVEALGRKGGN
NT seq
510 nt
NT seq
+upstream
nt +downstream
nt
atgcacagccgtatcggggtctatcccggcaccttcgatccgatcacccgcggacatatg
gacatcatccggcgcggcgcgaagctggtcgatcggctggtgatcggcgtgacgaccaat
ccgtccaagtctccgatgttcaccgtggaggaacgcatggcgatggtccggcgcgaggtc
gaggatctcgggggatcgatcgaggtggtcagcttcgattcgctgctgatggactttgcc
gagcgcgagcgcgccagcgtgatcgtccgcggcctgcgcgcggtggcggacttcgaatac
gaatatcagatggcgggcatgaatcagcagatcaacgaccggatcgagacggtcttcctg
atggccgatgtctcgctccagccgatcgccagccggctggtcaaggaaatcgcgctctat
ggcggcccgatccaccgcttcgtcacccccgccgtggaggccgatgtcgccgcccgcgtc
gaggcgctcgggcgcaagggcgggaactga
DBGET
integrated database retrieval system