Sphingobium sp. RSMS: EGM87_01160 Help Entry EGM87_01160       CDS       T10811                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism sprs  Sphingobium sp. RSMS Pathway sprs00190   Oxidative phosphorylation sprs01100   Metabolic pathways Module sprs_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sprs00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     EGM87_01160  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sprs00194]     EGM87_01160 Photosynthesis proteins [BR:sprs00194]  Photosystem and electron transport system   F-type ATPase [OT]    EGM87_01160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  UXC91132 LinkDB All DBs Position 1:complement(256983..257237) Genome browser AA seq 84 aa AA seqDB search MALHFELVTPEKLVRSEEVYQVVVPGTDGDFGVLEGHAPFMSTVRDGTIQIFANAGAAPE IIPVRGGFAEVNEKGLTVLAEHAG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcactgcatttcgaactcgtgaccccggaaaagctcgtccgctcggaagaggtctat caggtggtcgtccccggcaccgatggcgacttcggcgtgctggagggccatgcgcccttc atgtcgaccgtccgtgacggcacaatccagatcttcgccaacgccggcgccgccccggaa atcatcccggtccgcggcggctttgccgaggtgaacgaaaagggcctcaccgtccttgcg gaacatgccggctga

DBGET integrated database retrieval system