Sphingobacterium sp. R2: VXM68_13680 Help Entry VXM68_13680       CDS       T10631                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sprz  Sphingobacterium sp. R2 Pathway sprz00998   Biosynthesis of various antibiotics sprz01100   Metabolic pathways sprz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sprz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VXM68_13680    00074 Mycolic acid biosynthesis     VXM68_13680   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VXM68_13680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  XCY03692 LinkDB All DBs Position 3330225..3330479 Genome browser AA seq 84 aa AA seqDB search MNREELIDALKPIISPYTTNQEAFGKLNEATDFIRDLQINSANLVDIVLDIEEKFDIVIE NPDMERMLNVGAAVEIIESKLQEK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaatagagaagaattgatcgatgctttaaagccaatcatatcaccatatacgacaaac caggaagctttcggaaagcttaatgaggcgaccgattttattcgtgatctgcaaatcaac tcggccaatctggttgatattgttctagatattgaagaaaagttcgatatagtaattgaa aatcctgatatggaacgtatgcttaatgtcggagctgcagtcgaaataatcgagagcaag ttacaagaaaaatga

DBGET integrated database retrieval system