Staphylococcus shinii: JMB28_08580 Help Entry JMB28_08580       CDS       T08256                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spsd  Staphylococcus shinii Pathway spsd01100   Metabolic pathways spsd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spsd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JMB28_08580    00074 Mycolic acid biosynthesis     JMB28_08580   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JMB28_08580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QRA15706 LinkDB All DBs Position complement(1809346..1809579) Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDAEKVTKDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVNFINSIQK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgacaaagtaaaagatatcattgttgaccgtttaggtgttgacgctgaa aaagttactaaagatgcatcttttaaagatgatttaggcgctgactcactagatatcgct gaattagtaatggaattagaagacgaatttggtactgaaattccagatgaagaagctgaa aaaatcaacacagttggtgacgcggttaactttatcaatagtattcaaaaataa

DBGET integrated database retrieval system