Shewanella psychropiezotolerans: FM037_25935 Help Entry FM037_25935       CDS       T07745                                  Symbol zapB Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism spsh  Shewanella psychropiezotolerans Brite KEGG Orthology (KO) [BR:spsh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:spsh03036]     FM037_25935 (zapB) Chromosome and associated proteins [BR:spsh03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     FM037_25935 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB YabA KIP1 Nuf2_DHR10-like CENP-Q SlyX Motif Other DBs NCBI-ProteinID:  QDO86067 LinkDB All DBs Position 5941991..5942194 Genome browser AA seq 67 aa AA seqDB search MSLELLSKLETKIQATLETIELLKMELEEEKQKGISLIEQNQQLSQDLNSWNEKVTGLVG LLNEEVS NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgagccttgaactactgtccaagctggaaacaaaaatccaagcaacactcgaaactatt gagctattgaaaatggagcttgaagaagagaagcagaaaggcattagccttattgagcaa aaccaacagctgagccaagatcttaattcttggaacgaaaaagtcaccggactcgttggc ttgctcaatgaagaagtgagctag

DBGET integrated database retrieval system