Shewanella psychrotolerans: K0I62_01625 Help Entry K0I62_01625       CDS       T09306                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spsj  Shewanella psychrotolerans Pathway spsj01100   Metabolic pathways spsj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spsj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K0I62_01625    00074 Mycolic acid biosynthesis     K0I62_01625   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K0I62_01625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QYK01713 LinkDB All DBs Position complement(346346..346600) Genome browser AA seq 84 aa AA seqDB search MSLQNKIKQLIIDCLDLEDVSIDDIESDAPLFGEGLGLDSIDALELGLAIKKQFDVKIEA NSEATKAHFYSVASLASFIETQRG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagcttacaaaacaaaattaaacaactgatcattgattgcttagatcttgaagacgtt agcatcgacgatattgaatctgatgcaccgctatttggcgaaggtttggggttagactcg attgatgcactcgaactgggcttagcgattaaaaagcagtttgatgtcaaaattgaagca aattccgaggcaactaaagcccacttttacagtgtggccagtctcgctagtttcattgaa acccagcgtggttag

DBGET integrated database retrieval system