Shewanella psychrophila: Sps_00381
Help
Entry
Sps_00381 CDS
T05063
Name
(GenBank) LSU ribosomal protein L18P
KO
K02881
large subunit ribosomal protein L18
Organism
spsw
Shewanella psychrophila
Pathway
spsw03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
spsw00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
Sps_00381
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
spsw03011
]
Sps_00381
Ribosome [BR:
spsw03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
Sps_00381
Bacteria
Sps_00381
Archaea
Sps_00381
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
TrkA_C
Motif
Other DBs
NCBI-ProteinID:
AQS35593
UniProt:
A0A1S6HJA2
LinkDB
All DBs
Position
410722..411072
Genome browser
AA seq
116 aa
AA seq
DB search
MDKKTSRLRRALRARKKIQELGVNRLVVHRTPRHTYAQVISPDSQVLASASTAEKAVSEQ
LKYTGNVDAAKVVGKTVAERAIEKGVTVVAFDRSGFKYHGRVAALADAAREAGLKF
NT seq
351 nt
NT seq
+upstream
nt +downstream
nt
atggataagaaaacatctcgcttacgtcgcgcattacgcgcccgtaagaagatccaagag
ctgggcgttaaccgtctggttgtacatcgtacaccacgtcacacctatgctcaggtaatc
agccctgattcacaggttttggcgtcagcttctactgctgagaaagcggtatcagagcag
ctaaagtacacaggcaacgtagatgcagcaaaagtagtgggtaaaaccgtcgctgagcgt
gctatcgaaaaaggcgtgactgtagttgcattcgatcgttccggtttcaagtatcacgga
cgtgtagctgcattagcagacgccgctcgtgaagctggcctcaagttctaa
DBGET
integrated database retrieval system