Shewanella psychrophila: Sps_03330 Help Entry Sps_03330         CDS       T05063                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spsw  Shewanella psychrophila Pathway spsw00998   Biosynthesis of various antibiotics spsw01100   Metabolic pathways spsw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spsw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sps_03330    00074 Mycolic acid biosynthesis     Sps_03330   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sps_03330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AQS38466 UniProt:  A0A1S6HSG0 LinkDB All DBs Position 3830481..3830735 Genome browser AA seq 84 aa AA seqDB search MKLHNEIKQLIIECLDLEDVTIDDIESEAALFGEGLGLDSIDALELGLAIKKQFDVKIEA NSDATKAHFYSVASLASFIESQQA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaaactacataacgaaataaaacaattaatcatagaatgcttggatcttgaagatgtc accatcgatgatatcgaatccgaggcggcgctttttggtgaaggtctggggttagactca atcgatgccctggagcttggtttagcgattaagaagcagttcgatgtcaaaattgaagcc aattcagatgctactaaggcacatttttatagtgtggcaagtctggccagctttatcgaa tcacagcaagcttag

DBGET integrated database retrieval system